DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and AT5G24240

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_197812.1 Gene:AT5G24240 / 832491 AraportID:AT5G24240 Length:574 Species:Arabidopsis thaliana


Alignment Length:126 Identity:31/126 - (24%)
Similarity:50/126 - (39%) Gaps:17/126 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VAPTSTILEVKHQIEAELQISATNQKLLLLGRPLN-NEQTIASYPNIKEGTKLNLVVIKPCLRDS 80
            |..:.:|..||.:|::........||||..||.:: |:..|..| .:.:|..|:||:....|:..
plant    48 VMESDSIASVKLRIQSIKGFFVKKQKLLYDGREVSRNDSQIRDY-GLADGKLLHLVIRLSDLQAI 111

  Fly    81 ILRGFRKHYSEPLAERMTN---------------EFMADFERKINEQSLDDLERLADSIVN 126
            .:|.......|.:.||..|               ....|.|..::.:.|||...:.|...|
plant   112 SVRTVDGKEFELVVERSRNVGYVKQQIASKEKELGIPRDHELTLDGEELDDQRLITDLCQN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 17/55 (31%)
Tugs 87..121 CDD:465528 9/48 (19%)
AT5G24240NP_197812.1 Ubl1_cv_Nsp3_N-like 34..105 CDD:475130 18/57 (32%)
Ubl_ubiquitin_like 111..180 CDD:340559 12/62 (19%)
PI3_PI4_kinase 266..521 CDD:395364
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.