DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and AT7SL-1

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_192206.1 Gene:AT7SL-1 / 828121 AraportID:AT4G02970 Length:270 Species:Arabidopsis thaliana


Alignment Length:53 Identity:16/53 - (30%)
Similarity:26/53 - (49%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNE 53
            |.:.|....|...:|.:....|:||:|.:||....|..:.|.|.|.|:.|.::
plant     1 MNVYIDTETGSSFSITIDFGETVLEIKEKIEKSQGIPVSKQILYLDGKALEDD 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 16/53 (30%)
Tugs 87..121 CDD:465528
AT7SL-1NP_192206.1 ubiquitin 3..74 CDD:459726 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.