DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Rps27a

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_077239.1 Gene:Rps27a / 78294 MGIID:1925544 Length:156 Species:Mus musculus


Alignment Length:92 Identity:33/92 - (35%)
Similarity:54/92 - (58%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |||.:|.|.||..|:||.|:.||..||.:|:.:..|....|:|:..|:.|.:.:|::.| ||::.
Mouse     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY-NIQKE 64

  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEP 92
            :.|:||:   .||....:..:|.|:.|
Mouse    65 STLHLVL---RLRGGAKKRKKKSYTTP 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 27/70 (39%)
Tugs 87..121 CDD:465528 3/6 (50%)
Rps27aNP_077239.1 Ubl_ubiquitin 1..76 CDD:340501 30/78 (38%)
Ribosomal_S27 103..147 CDD:460261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.