DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubl4b

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_080537.1 Gene:Ubl4b / 67591 MGIID:1914841 Length:188 Species:Mus musculus


Alignment Length:141 Identity:31/141 - (21%)
Similarity:68/141 - (48%) Gaps:21/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |.:|:|:|.|:.|:::|:...::..:|..:...||:....|.||..|:.|.:::.::.| :|...
Mouse     1 MFLTVKLLLGRRCSLKVSGKESVATLKKLVSQHLQVPEEQQHLLFRGQLLADDKYLSDY-SIGPN 64

  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEPL----------------AERMTNEFMADFERKINEQSL 114
            ..:|:::..|  .|:.|.  :.|.::||                |:.:......:.|.::...||
Mouse    65 ASINVIMRPP--EDAALD--KTHQTQPLWLQLGQVLDKHFGAKDAKTVLGFLRQEHEERLQRLSL 125

  Fly   115 DDLERLADSIV 125
            :.||:|...::
Mouse   126 EALEQLVGQLL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 18/70 (26%)
ubiquitin 6..72 CDD:278661 16/65 (25%)
Ubl4bNP_080537.1 UBQ 1..74 CDD:294102 18/73 (25%)
UBQ 1..72 CDD:214563 18/71 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5244
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48611
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005554
OrthoInspector 1 1.000 - - otm44155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.