DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and RAD23B

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_002865.1 Gene:RAD23B / 5887 HGNCID:9813 Length:409 Species:Homo sapiens


Alignment Length:78 Identity:25/78 - (32%)
Similarity:43/78 - (55%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISA---TNQKLLLLGRPLNNEQTIASYPNI 62
            ||:|:|.|:.:...|::.|..|:..:|.:||:|....|   ..|||:..|:.||::..:..| .|
Human     1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEY-KI 64

  Fly    63 KEGTKLNLVVIKP 75
            .|...:.::|.||
Human    65 DEKNFVVVMVTKP 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 22/73 (30%)
Tugs 87..121 CDD:465528
RAD23BNP_002865.1 rad23 1..407 CDD:273167 25/78 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..276
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.