DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubqln1

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_081118.4 Gene:Ubqln1 / 56085 MGIID:1860276 Length:582 Species:Mus musculus


Alignment Length:72 Identity:17/72 - (23%)
Similarity:37/72 - (51%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |::|:|..|.|: ...|...|::.:.|.:|....:.......|:..|:.|.::.|::.: .|.:|
Mouse    28 MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHIDQLVLIFAGKILKDQDTLSQH-GIHDG 90

  Fly    66 TKLNLVV 72
            ..::||:
Mouse    91 LTVHLVI 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 16/70 (23%)
ubiquitin 6..72 CDD:278661 14/65 (22%)
Ubqln1NP_081118.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
UBQ 28..98 CDD:214563 17/72 (24%)
hPLIC_N 28..98 CDD:176403 17/72 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..136
Interaction with UBXN4. /evidence=ECO:0000250|UniProtKB:Q9UMX0 169..422
STI1 173..210 CDD:128966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..365
STI1 384..416 CDD:128966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..513
UBA_PLICs 539..578 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.