powered by:
Protein Alignment CG7215 and Ubqln1
DIOPT Version :9
Sequence 1: | NP_001163644.1 |
Gene: | CG7215 / 3772662 |
FlyBaseID: | FBgn0038571 |
Length: | 130 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_081118.4 |
Gene: | Ubqln1 / 56085 |
MGIID: | 1860276 |
Length: | 582 |
Species: | Mus musculus |
Alignment Length: | 72 |
Identity: | 17/72 - (23%) |
Similarity: | 37/72 - (51%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
|::|:|..|.|: ...|...|::.:.|.:|....:.......|:..|:.|.::.|::.: .|.:|
Mouse 28 MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHIDQLVLIFAGKILKDQDTLSQH-GIHDG 90
Fly 66 TKLNLVV 72
..::||:
Mouse 91 LTVHLVI 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.