DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and ubl7a

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001017765.1 Gene:ubl7a / 550462 ZFINID:ZDB-GENE-050417-285 Length:379 Species:Danio rerio


Alignment Length:109 Identity:24/109 - (22%)
Similarity:49/109 - (44%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VKHQIEAELQISATNQKLLLL---GRPLNNEQTIASYPNIKEGTKLNL---------VVIKPCLR 78
            :|..:.|::..:..:.:|:.|   ||.|.::.|:.|| .|:.|:.:::         :..:|..:
Zfish    43 LKQLVSAQIPDAIPDPELIELVYCGRKLKDDLTLESY-GIQSGSTVHILRKSWPEPEIHPEPVDK 106

  Fly    79 DSILRGFR-----KHYSEPLAERMTNEFMADFERKINEQSLDDL 117
            .:..|.||     .|.|....|.:       |:...|::|||.:
Zfish   107 VAAAREFRVLQAALHTSTAYRESV-------FKMLNNKESLDQI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 12/57 (21%)
ubiquitin 6..72 CDD:278661 12/57 (21%)
ubl7aNP_001017765.1 UBQ 19..92 CDD:294102 12/49 (24%)
UBQ <40..88 CDD:214563 12/45 (27%)
UBA_UBL7 337..374 CDD:270511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.