DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubqln2

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_061268.2 Gene:Ubqln2 / 54609 MGIID:1860283 Length:638 Species:Mus musculus


Alignment Length:73 Identity:20/73 - (27%)
Similarity:40/73 - (54%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLL-GRPLNNEQTIASYPNIKE 64
            :::|:|..|.|: ...|...||:.:.|..|....: |.|:|.:|:. |:.|.::.|:..: .|.:
Mouse    33 IKVTVKTPKEKE-EFAVPENSTVQQFKEAISKRFK-SQTDQLVLIFAGKILKDQDTLMQH-GIHD 94

  Fly    65 GTKLNLVV 72
            |..::||:
Mouse    95 GLTVHLVI 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 19/71 (27%)
ubiquitin 6..72 CDD:278661 18/66 (27%)
Ubqln2NP_061268.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
UBQ 33..103 CDD:214563 20/73 (27%)
hPLIC_N 33..103 CDD:176403 20/73 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..364
STI1 396..440 CDD:128966
11 X 3 AA tandem repeats P-X-X 505..537
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 528..570
UBA_PLICs 595..634 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.