DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7215 and UBQLN3

DIOPT Version :9

Sequence 1:	NP_001163644.1	Gene:	CG7215 / 3772662	FlyBaseID:	FBgn0038571	Length:	130	Species:	Drosophila melanogaster
Sequence 2:	NP_001334025.1	Gene:	UBQLN3 / 50613	HGNCID:	12510	Length:	655	Species:	Homo sapiens

Alignment Length:	72	Identity:	17/72 - (23%)
Similarity:	37/72 - (51%)	Gaps:	2/72 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            :::|:|..|.|: ...|..|.||.::|.:|....:.......|:..|:.|.:..::|.. .:::|
Human    22 IKVTVKTPKDKE-DFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQC-GVRDG 84

  Fly    66 TKLNLVV 72
            ..::||:
Human    85 LTVHLVI 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7215	NP_001163644.1	UBQ	1..72	CDD:214563	16/70 (23%)
CG7215	NP_001163644.1	ubiquitin	6..72	CDD:278661	15/65 (23%)
UBQLN3	NP_001334025.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	102..124
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	277..330
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	364..399
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	412..447
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900