DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and UBQLN3

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_059509.1 Gene:UBQLN3 / 50613 HGNCID:12510 Length:655 Species:Homo sapiens


Alignment Length:72 Identity:17/72 - (23%)
Similarity:37/72 - (51%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            :::|:|..|.|: ...|..|.||.::|.:|....:.......|:..|:.|.:..::|.. .:::|
Human    22 IKVTVKTPKDKE-DFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQC-GVRDG 84

  Fly    66 TKLNLVV 72
            ..::||:
Human    85 LTVHLVI 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 16/70 (23%)
Tugs 87..121 CDD:465528
UBQLN3NP_059509.1 Ubl_PLICs 20..92 CDD:340506 17/72 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..124
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..399
PHA03378 <368..627 CDD:223065
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..447
UBA_PLICs 615..654 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.