DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and nedd8l

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001002557.1 Gene:nedd8l / 436830 ZFINID:ZDB-GENE-040718-295 Length:80 Species:Danio rerio


Alignment Length:84 Identity:28/84 - (33%)
Similarity:47/84 - (55%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |.|.:|.|.||:..|::.||..:..:|.::|.:..|....|:|:..|:.:|:|:|.|.| .|:.|
Zfish     1 MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADY-KIQGG 64

  Fly    66 TKLNLVVIKPCLRDSILRG 84
            :.|:||:        .|||
Zfish    65 SVLHLVL--------ALRG 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 24/70 (34%)
Tugs 87..121 CDD:465528
nedd8lNP_001002557.1 Ubl_NEDD8 3..76 CDD:340504 27/82 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.