DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and ubl7b

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:XP_005173742.1 Gene:ubl7b / 393331 ZFINID:ZDB-GENE-040426-1334 Length:371 Species:Danio rerio


Alignment Length:104 Identity:27/104 - (25%)
Similarity:46/104 - (44%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VKHQIEAELQISATNQKLL---LLGRPLNNEQTIASYPNIKEGTKLNL---------VVIKPCLR 78
            :|..|..:|..|..:..|:   ..|..|.::.|:.|| .||.|:.|::         :..:|..|
Zfish    40 LKQLISVQLSDSLPDPDLIDFVHCGCVLKDDLTLDSY-GIKSGSTLHIIKKTWPEPEIQPEPVNR 103

  Fly    79 DSILRGFRKHYSEPLAERMTNEFMADFERKINEQSLDDL 117
            .:..|.||...:..|:.....|  |.|:...|::|||.:
Zfish   104 SAAAREFRMLQAAMLSNATYRE--AVFKMLANKESLDQI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 14/57 (25%)
ubiquitin 6..72 CDD:278661 14/57 (25%)
ubl7bXP_005173742.1 BMSC_UbP_N 15..89 CDD:176410 14/49 (29%)
Herpes_capsid <232..300 CDD:283714
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.