DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and zgc:56596

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_956594.1 Gene:zgc:56596 / 393270 ZFINID:ZDB-GENE-040426-1089 Length:157 Species:Danio rerio


Alignment Length:146 Identity:45/146 - (30%)
Similarity:72/146 - (49%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |.:|:|.|:||:|.::|.....:..||..:...|.|.|:.|:||..|:.|.:|..::.| :|...
Zfish     1 MILTVKPLQGKECNVQVTENEKVSTVKELVSERLNIPASQQRLLYKGKALADEHRLSDY-SIGPE 64

  Fly    66 TKLNLVVIKPCLRDSILRG--------------------FRKHYSEPLAERMTNEFMADFERKIN 110
            .||||||.....|.|...|                    ..||:|...|.::..:.:.|:||.:.
Zfish    65 AKLNLVVRPAGERSSGAVGTSSANNDKGGSGVWQLLSTVLAKHFSPADAAKVQEQLIKDYERSLR 129

  Fly   111 EQSLDDLERLADSIVN 126
            :.||||:||||..:::
Zfish   130 QLSLDDIERLASRLLH 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 25/70 (36%)
ubiquitin 6..72 CDD:278661 23/65 (35%)
zgc:56596NP_956594.1 GDX_N 1..74 CDD:176402 27/73 (37%)
UBQ 1..72 CDD:214563 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5319
OMA 1 1.010 - - QHG48611
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005554
OrthoInspector 1 1.000 - - oto39918
orthoMCL 1 0.900 - - OOG6_109187
Panther 1 1.100 - - LDO PTHR46555
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5392
SonicParanoid 1 1.000 - - X2416
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.