DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubqn

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster


Alignment Length:146 Identity:31/146 - (21%)
Similarity:56/146 - (38%) Gaps:32/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            :.:.:|..|.|. |:||...|.|.:.|..:..:.:.......|:..|:.:.:..|:..: |||:.
  Fly     9 INVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMH-NIKDN 71

  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEPLAERMT--------------------NEFMADFERKIN 110
            ..::||:..|      .|...:...:|...|.|                    |.|| |.:.::.
  Fly    72 LTVHLVIKAP------TRNNEQPARQPADVRQTPFGLNQFGGLAGMEALGAGSNTFM-DLQARMQ 129

  Fly   111 EQSL---DDLERLADS 123
            .:.|   |.|..|.|:
  Fly   130 NELLNNGDMLRSLMDN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 16/70 (23%)
Tugs 87..121 CDD:465528 10/56 (18%)
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 17/71 (24%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.