DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and CG11700

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster


Alignment Length:151 Identity:40/151 - (26%)
Similarity:75/151 - (49%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |||.:|.|.||..|:||.|:.||..||.:|:.:.:....:|:|:..|:.|.|.:|::.| ||::.
  Fly    77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDY-NIQKE 140

  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEPLA------ERMTNEFMADFERKINE------------- 111
            :.:.||     ||   |||..:.:.:.|.      |...::.:.:.:.:|::             
  Fly   141 STIYLV-----LR---LRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIF 197

  Fly   112 --QSLDDLERLADSIVNRAAT 130
              :.|:|...|:|..:.:.:|
  Fly   198 AGKQLEDGRTLSDYNIQKEST 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 26/70 (37%)
ubiquitin 6..72 CDD:278661 23/65 (35%)
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 31/83 (37%)
UBQ 77..148 CDD:214563 27/76 (36%)
Ubiquitin 153..228 CDD:176398 8/66 (12%)
UBQ 153..224 CDD:214563 8/66 (12%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.