DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7215 and UBQLN1

DIOPT Version :9

Sequence 1:	NP_001163644.1	Gene:	CG7215 / 3772662	FlyBaseID:	FBgn0038571	Length:	130	Species:	Drosophila melanogaster
Sequence 2:	NP_038466.2	Gene:	UBQLN1 / 29979	HGNCID:	12508	Length:	589	Species:	Homo sapiens

Alignment Length:	73	Identity:	20/73 - (27%)
Similarity:	42/73 - (57%)	Gaps:	4/73 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLL-GRPLNNEQTIASYPNIKE 64
            |::|:|..|.|: ...|...|::.:.|.:|....: |.|:|.:|:. |:.|.::.|::.: .|.:
Human    37 MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFK-SHTDQLVLIFAGKILKDQDTLSQH-GIHD 98

  Fly    65 GTKLNLVV 72
            |..::||:
Human    99 GLTVHLVI 106

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7215	NP_001163644.1	UBQ	1..72	CDD:214563	19/71 (27%)
CG7215	NP_001163644.1	ubiquitin	6..72	CDD:278661	17/66 (26%)
UBQLN1	NP_038466.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..35
		UBQ	37..107	CDD:214563	20/73 (27%)
		hPLIC_N	37..107	CDD:176403	20/73 (27%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	110..145
		Interaction with UBXN4. /evidence=ECO:0000269\|PubMed:19822669	178..428
		STI1	182..219	CDD:128966
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	295..371
		STI1	390..422	CDD:128966
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	488..520
		UBA_PLICs	546..585	CDD:270582
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900