DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7215 and UBQLN2

DIOPT Version :9

Sequence 1:	NP_001163644.1	Gene:	CG7215 / 3772662	FlyBaseID:	FBgn0038571	Length:	130	Species:	Drosophila melanogaster
Sequence 2:	NP_038472.2	Gene:	UBQLN2 / 29978	HGNCID:	12509	Length:	624	Species:	Homo sapiens

Alignment Length:	73	Identity:	19/73 - (26%)
Similarity:	40/73 - (54%)	Gaps:	4/73 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLL-GRPLNNEQTIASYPNIKE 64
            :::|:|..|.|: ...|...|::.:.|..|....: |.|:|.:|:. |:.|.::.|:..: .|.:
Human    33 IKVTVKTPKEKE-EFAVPENSSVQQFKEAISKRFK-SQTDQLVLIFAGKILKDQDTLIQH-GIHD 94

  Fly    65 GTKLNLVV 72
            |..::||:
Human    95 GLTVHLVI 102

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7215	NP_001163644.1	UBQ	1..72	CDD:214563	18/71 (25%)
CG7215	NP_001163644.1	ubiquitin	6..72	CDD:278661	17/66 (26%)
UBQLN2	NP_038472.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..32
		UBQ	33..103	CDD:214563	19/73 (26%)
		hPLIC_N	33..103	CDD:176403	19/73 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	106..141
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	287..349
		STI1	382..426	CDD:128966
		12 X 3 AA tandem repeats of P-X-X	491..526
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	512..556
		UBA_PLICs	581..620	CDD:270582
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900