DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubqlnl

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001013921.1 Gene:Ubqlnl / 293287 RGDID:1307202 Length:612 Species:Rattus norvegicus


Alignment Length:99 Identity:23/99 - (23%)
Similarity:41/99 - (41%) Gaps:14/99 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            :::.:|. .|......||..:::.:.|.|:.:..:.......|:.:||.|.:..|: |...|.:|
  Rat    31 IRVIVKT-PGNQNVFTVAEDTSVRQFKEQLSSHFKCQMEQLVLVSMGRLLKDHDTL-SQRGITDG 93

  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEPLAERMTN 99
            ..:: ||||           .||.|..|.....|
  Rat    94 HTIH-VVIK-----------SKHGSRSLTHSFRN 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 14/70 (20%)
Tugs 87..121 CDD:465528 5/13 (38%)
UbqlnlNP_001013921.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Ubl_PLICs 31..101 CDD:340506 16/72 (22%)
UBA_PLICs 569..606 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.