DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubd

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_445751.2 Gene:Ubd / 29168 RGDID:69418 Length:161 Species:Rattus norvegicus


Alignment Length:63 Identity:18/63 - (28%)
Similarity:33/63 - (52%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEGT-KLNLVVIKP 75
            |.:...:..:.::...|.::.::|..:|.|||..:.|...:.::||...||.| .|.|.|:||
  Rat    17 TFDTTMSDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRALSSYGIDKENTIHLTLKVVKP 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 15/58 (26%)
Tugs 87..121 CDD:465528
UbdNP_445751.2 Ubl1_cv_Nsp3_N-like 8..78 CDD:475130 16/60 (27%)
Ubl2_FAT10 86..155 CDD:340573
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.