DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and AT1G53950

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001319219.1 Gene:AT1G53950 / 28717351 AraportID:AT1G53950 Length:144 Species:Arabidopsis thaliana


Alignment Length:72 Identity:26/72 - (36%)
Similarity:40/72 - (55%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |.|.||.|.|:..|.||..:.||.|:|.:.|.:..|....|:|:..||.|.:.:.|:.| |||..
plant    69 MMIFIKTLTGRTNTYEVKGSDTIRELKAKHEEKEGIPVEQQRLIFQGRVLEDSKAISDY-NIKHE 132

  Fly    66 TKLNLVV 72
            :.|::.:
plant   133 STLHITL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 26/70 (37%)
Tugs 87..121 CDD:465528
AT1G53950NP_001319219.1 Ubl1_cv_Nsp3_N-like 69..139 CDD:475130 26/70 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.