DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Zfand4

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:XP_038963095.1 Gene:Zfand4 / 286998 RGDID:628707 Length:815 Species:Rattus norvegicus


Alignment Length:113 Identity:28/113 - (24%)
Similarity:51/113 - (45%) Gaps:6/113 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |::.|:.|.|....:.|:|...::.||.:|:....|....|.|:.....|.::..:..| ||.||
  Rat    72 MELFIETLTGTCFELRVSPFEAVISVKGKIQRLEGIPICQQHLIWNNMELEDDYCLNDY-NISEG 135

  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEPLAERMTNEFMADFERKINEQS 113
            ..|.||:   .:|...:...:....:||.|  ..|:|.....::.|::
  Rat   136 CTLKLVL---AMRGGPISTRKVPVEDPLRE--LAEYMDSSRDEVWEKT 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 20/70 (29%)
ubiquitin 6..72 CDD:278661 18/65 (28%)
Zfand4XP_038963095.1 Ubl_ZFAND4 72..145 CDD:340500 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.