DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubqlnl

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_941026.2 Gene:Ubqlnl / 244179 MGIID:2685336 Length:610 Species:Mus musculus


Alignment Length:102 Identity:21/102 - (20%)
Similarity:38/102 - (37%) Gaps:20/102 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            :::.:|. .|......||..:.:.:.|..:.|..:.......|:.:||.|.:..|: |...|.:|
Mouse    31 IRVIVKT-PGNQIIFTVADDTLVRQFKEILSAHFKCQMEQLVLVFMGRLLKDHDTL-SQRGITDG 93

  Fly    66 TKL------------------NLVVIKPCLRDSILRG 84
            ..:                  |||...||.:|...:|
Mouse    94 HIIHVVIKSKHGPRSLAHSFRNLVTNNPCHQDRNPKG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 16/88 (18%)
Tugs 87..121 CDD:465528
UbqlnlNP_941026.2 Ubl1_cv_Nsp3_N-like 31..101 CDD:475130 14/71 (20%)
UBA_PLICs 567..606 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.