DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Ubc

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_062613.3 Gene:Ubc / 22190 MGIID:98889 Length:734 Species:Mus musculus


Alignment Length:151 Identity:42/151 - (27%)
Similarity:74/151 - (49%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |||.:|.|.||..|:||.|:.||..||.:|:.:..|....|:|:..|:.|.:.:|::.| ||::.
Mouse     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY-NIQKE 64

  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEPLA------ERMTNEFMADFERKINE------------- 111
            :.|:||     ||   |||..:.:.:.|.      |...::.:.:.:.||.:             
Mouse    65 STLHLV-----LR---LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF 121

  Fly   112 --QSLDDLERLADSIVNRAAT 130
              :.|:|...|:|..:.:.:|
Mouse   122 AGKQLEDGRTLSDYNIQKEST 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 27/70 (39%)
ubiquitin 6..72 CDD:278661 24/65 (37%)
UbcNP_062613.3 Ubiquitin 1..76 CDD:176398 32/83 (39%)
UBQ 1..72 CDD:214563 28/76 (37%)
Ubiquitin 77..152 CDD:176398 9/66 (14%)
UBQ 77..148 CDD:214563 9/66 (14%)
Ubiquitin 153..228 CDD:176398
UBQ 153..224 CDD:214563
Ubiquitin 229..304 CDD:176398
UBQ 229..300 CDD:214563
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Ubiquitin 533..608 CDD:176398
UBQ 533..604 CDD:214563
Ubiquitin 609..684 CDD:176398
UBQ 609..680 CDD:214563
UBQ 685..>713 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.