DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and FAU

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001988.1 Gene:FAU / 2197 HGNCID:3597 Length:133 Species:Homo sapiens


Alignment Length:43 Identity:14/43 - (32%)
Similarity:24/43 - (55%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTI 56
            |.||....|:.::|..:.:...|:..:|.:||.|.||.:|.|:
Human    12 TFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATL 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 14/43 (33%)
Tugs 87..121 CDD:465528
FAUNP_001988.1 Ubl_FUBI 1..74 CDD:340491 14/43 (33%)
Ribosomal_S30 75..132 CDD:398432
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..110
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.