DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7215 and Rad23b

DIOPT Version :9

Sequence 1:	NP_001163644.1	Gene:	CG7215 / 3772662	FlyBaseID:	FBgn0038571	Length:	130	Species:	Drosophila melanogaster
Sequence 2:	NP_033037.2	Gene:	Rad23b / 19359	MGIID:	105128	Length:	416	Species:	Mus musculus

Alignment Length:	78	Identity:	24/78 - (30%)
Similarity:	43/78 - (55%)	Gaps:	4/78 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISA---TNQKLLLLGRPLNNEQTIASYPNI 62
            ||:|:|.|:.:...|::.|..|:..:|.:||:|....|   ..|||:..|:.|:::..:..| .|
Mouse     1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEY-KI 64

  Fly    63 KEGTKLNLVVIKP 75
            .|...:.::|.||
Mouse    65 DEKNFVVVMVTKP 77

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7215	NP_001163644.1	UBQ	1..72	CDD:214563	21/73 (29%)
CG7215	NP_001163644.1	ubiquitin	6..72	CDD:278661	18/68 (26%)
Rad23b	NP_033037.2	rad23	1..414	CDD:273167	24/78 (31%)
		RAD23_N	1..78	CDD:176400	24/78 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	83..175
		UBA1_Rad23	189..228	CDD:270560
		XPC-binding	276..331	CDD:286376
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	333..356
		UBA2_HR23B	372..416	CDD:270611
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900