powered by:
Protein Alignment CG7215 and F52C6.4
DIOPT Version :9
Sequence 1: | NP_001163644.1 |
Gene: | CG7215 / 3772662 |
FlyBaseID: | FBgn0038571 |
Length: | 130 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379809.1 |
Gene: | F52C6.4 / 186086 |
WormBaseID: | WBGene00018661 |
Length: | 100 |
Species: | Caenorhabditis elegans |
Alignment Length: | 30 |
Identity: | 11/30 - (36%) |
Similarity: | 18/30 - (60%) |
Gaps: | 1/30 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQITIKVLKGKDCTIEVAPTSTILEVKHQI 30
|:|.:|..: |..|::.|.:.||..||.:|
Worm 72 MRIYVKTCE-KTITLDTAASDTIASVKAKI 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.