DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and F52C6.3

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_494127.2 Gene:F52C6.3 / 186085 WormBaseID:WBGene00018660 Length:197 Species:Caenorhabditis elegans


Alignment Length:65 Identity:19/65 - (29%)
Similarity:35/65 - (53%) Gaps:2/65 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLN--NEQTIASYPNIKEGTKLNLVV 72
            |:.||::.:.:.|:..||.:|..:|:|....|||||....|:  ::.:.....:.:.|:.|.|.|
 Worm   111 GRTCTLDTSASDTMASVKAKIWEKLRILPNTQKLLLENWDLDLFSDHSTLFDNSFENGSTLRLEV 175

  Fly    73  72
             Worm   176  175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 18/63 (29%)
Tugs 87..121 CDD:465528
F52C6.3NP_494127.2 Ubl1_cv_Nsp3_N-like 103..173 CDD:475130 17/61 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.