powered by:
Protein Alignment CG7215 and F34H10.1
DIOPT Version :9
Sequence 1: | NP_001163644.1 |
Gene: | CG7215 / 3772662 |
FlyBaseID: | FBgn0038571 |
Length: | 130 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001359527.1 |
Gene: | F34H10.1 / 185243 |
WormBaseID: | WBGene00009378 |
Length: | 63 |
Species: | Caenorhabditis elegans |
Alignment Length: | 34 |
Identity: | 6/34 - (17%) |
Similarity: | 17/34 - (50%) |
Gaps: | 6/34 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 LAERMTNEFMADFERKINEQSLDDLERLADSIVN 126
:.:::.:.|...|..| ::.:||..::|:
Worm 36 IVQKLISPFKDGFTCK------EEKQRLCFAVVS 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7215 | NP_001163644.1 |
UBQ |
1..72 |
CDD:214563 |
|
ubiquitin |
6..72 |
CDD:278661 |
|
F34H10.1 | NP_001359527.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.