DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and C16C8.5

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_494543.1 Gene:C16C8.5 / 182672 WormBaseID:WBGene00015843 Length:180 Species:Caenorhabditis elegans


Alignment Length:106 Identity:21/106 - (19%)
Similarity:35/106 - (33%) Gaps:21/106 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEGTKLNLVVIKPCLRDSILRGFRK 87
            :||.:..::..||....|||       :.|.:......|:|.|.  |.|.........:...::.
 Worm    42 LLEEQKSLKKRLQKVEENQK-------IENAKIKEELENLKNGG--NRVADNSLFEIFVFDDYKY 97

  Fly    88 HYSE------------PLAERMTNEFMADFERKINEQSLDD 116
            |..|            .:|..:.|:.:..|......|.|.|
 Worm    98 HAVEVRNSYLIRYVRVKVANLLNNDLVESFNLYYGGQKLQD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 12/48 (25%)
ubiquitin 6..72 CDD:278661 12/48 (25%)
C16C8.5NP_494543.1 UBQ 87..154 CDD:214563 8/52 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.