DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and ubq-2

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_499695.1 Gene:ubq-2 / 176718 WormBaseID:WBGene00006728 Length:128 Species:Caenorhabditis elegans


Alignment Length:84 Identity:31/84 - (36%)
Similarity:50/84 - (59%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            |||.:|.|.||..|:||..:.||..||.:|:.:..|....|:|:..|:.|.:.:|::.| ||::.
 Worm     1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY-NIQKE 64

  Fly    66 TKLNLV------VIKPCLR 78
            :.|:||      :|:|.||
 Worm    65 STLHLVLRLRGGIIEPSLR 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 27/76 (36%)
Tugs 87..121 CDD:465528
ubq-2NP_499695.1 Ubl_ubiquitin 1..76 CDD:340501 27/75 (36%)
Ribosomal_L40e 79..126 CDD:395807 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.