DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and F52C6.2

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_494128.3 Gene:F52C6.2 / 173558 WormBaseID:WBGene00018659 Length:228 Species:Caenorhabditis elegans


Alignment Length:62 Identity:19/62 - (30%)
Similarity:35/62 - (56%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEGTKLNLV 71
            ||...:.:..|.||..:|.:::.:..|....|:||..|..|.:.:|:| :..:::||.|:||
 Worm   164 GKTTAVSIKNTDTIGTLKLKVQEKEGIPPNQQRLLFKGSELMDYRTVA-HCGLRQGTSLDLV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 19/62 (31%)
ubiquitin 6..72 CDD:278661 19/62 (31%)
F52C6.2NP_494128.3 ubiquitin 157..224 CDD:365970 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.