DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and UBL4B

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_981957.1 Gene:UBL4B / 164153 HGNCID:32309 Length:174 Species:Homo sapiens


Alignment Length:143 Identity:30/143 - (20%)
Similarity:69/143 - (48%) Gaps:23/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASY---PNI 62
            |.:|:|:|.|:.|:::|:...::..:|..:...|::....|.||..|:.|.:::.::.|   || 
Human     1 MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPN- 64

  Fly    63 KEGTKLNLVVIKPCLRDSILRGFR---------------KHYSEPLAERMTNEFMADFERKINEQ 112
               ..:| |:::|..:.::....:               ||:....|:.:......:.|.::.:.
Human    65 ---ASIN-VIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKI 125

  Fly   113 SLDDLERLADSIV 125
            ||:.||:||..::
Human   126 SLEHLEQLAQYLL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 18/73 (25%)
ubiquitin 6..72 CDD:278661 16/68 (24%)
UBL4BNP_981957.1 UBQ 1..74 CDD:320785 19/77 (25%)
FlhF 20..>154 CDD:332151 23/124 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5332
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48611
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005554
OrthoInspector 1 1.000 - - otm42102
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.