DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7215 and UBQLNL

DIOPT Version :9

Sequence 1:	NP_001163644.1	Gene:	CG7215 / 3772662	FlyBaseID:	FBgn0038571	Length:	130	Species:	Drosophila melanogaster
Sequence 2:	NP_659490.4	Gene:	UBQLNL / 143630	HGNCID:	28294	Length:	475	Species:	Homo sapiens

Alignment Length:	121	Identity:	25/121 - (20%)
Similarity:	43/121 - (35%)	Gaps:	23/121 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 VAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEGTKLNLVVIK------- 74
            ||...::.:.|..:.|..|.......|:.:|..|.:..|: |...|.:|..:.||:..
Human    46 VADDISVRQFKEMLLAHFQCQMDQLVLVFMGCLLKDHDTL-SQRGIMDGHTIYLVIKSKQGSRSL 109

  Fly    75 -----------PCLRDSILRGFRKHYSEPLAERMTNEFMADF----ERKINEQSLD 115
                       ||.||...:|......:|.........:|.|    ..|::.|:|:
Human   110 AHSFRDLPTNDPCHRDRNTKGNSSRVHQPTGMNQAPVELAHFVGSDAPKVHTQNLE 165

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7215	NP_001163644.1	UBQ	1..72	CDD:214563	13/54 (24%)
CG7215	NP_001163644.1	ubiquitin	6..72	CDD:278661	13/54 (24%)
UBQLNL	NP_659490.4	UBQ	32..101	CDD:214563	14/55 (25%)
		UBQ	32..101	CDD:294102	14/55 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	113..138		5/24 (21%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	305..325
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900