DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and LOC1272322

DIOPT Version :10

Sequence 1:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:XP_311268.6 Gene:LOC1272322 / 1272322 VectorBaseID:AGAMI1_011087 Length:390 Species:Anopheles gambiae


Alignment Length:100 Identity:20/100 - (20%)
Similarity:40/100 - (40%) Gaps:23/100 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ESSFVKFVDSTAELLLSRKINVILFMGGIWHSASSSAIAPFHLVANHFKESKNLIDFSIVDVSET 128
            |::|.|||  .........|..:||.           |.|:..:.:.        |.::..:.: 
Mosquito   123 ENTFWKFV--RVSYFAFNYILALLFF-----------IPPYLRIPDQ--------DLALQQIYK- 165

  Fly   129 KLPYNL-NFDQLPKILITSADRSNTYMFLIKVVLF 162
            :||.|| |:.....:.:.:.|.:.:.:.:..||:|
Mosquito   166 ELPSNLPNWITKADVFVLATDITYSLLSVFLVVIF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 4/7 (57%)
Tugs 87..121 CDD:465528 5/33 (15%)
LOC1272322XP_311268.6 None

Return to query results.
Submit another query.