DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and Gm44504

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001265200.1 Gene:Gm44504 / 100169864 MGIID:5621304 Length:157 Species:Mus musculus


Alignment Length:150 Identity:47/150 - (31%)
Similarity:80/150 - (53%) Gaps:22/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            ||:|:|.|:|::|:::||....:..:||.:..:|.:....|:||..|:.|.:|:.::.| ||...
Mouse     1 MQLTVKALQGRECSLQVAEDELVSTLKHLVSDKLNVPVRQQRLLFKGKALADEKRLSDY-NIGPN 64

  Fly    66 TKLNLVVIKPC------------LRDS--------ILRGFRKHYSEPLAERMTNEFMADFERKIN 110
            :|||||| ||.            |.||        |.:...:|:|...|.|:..:...|::|.::
Mouse    65 SKLNLVV-KPLEKVLLEEGSAHRLVDSPATPIWQLISKVLARHFSVADASRVLEQLQRDYDRSLS 128

  Fly   111 EQSLDDLERLADSIVNRAAT 130
            ..:|||:||||...::...|
Mouse   129 RLTLDDIERLASRFLHPEVT 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 25/70 (36%)
ubiquitin 6..72 CDD:278661 22/65 (34%)
Gm44504NP_001265200.1 Ubl_UBL4A_like 1..72 CDD:340505 27/72 (38%)
Tugs 96..142 CDD:375372 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5244
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48611
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005554
OrthoInspector 1 1.000 - - otm44155
orthoMCL 1 0.900 - - OOG6_109187
Panther 1 1.100 - - LDO PTHR46555
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5392
SonicParanoid 1 1.000 - - X2416
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.