DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7215 and ubl4a

DIOPT Version :9

Sequence 1:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001096510.1 Gene:ubl4a / 100125140 XenbaseID:XB-GENE-6455973 Length:148 Species:Xenopus tropicalis


Alignment Length:136 Identity:50/136 - (36%)
Similarity:79/136 - (58%) Gaps:11/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65
            ||:|:|.||||:..|:|:...|:|.||..:|.:|::..:.|:||..|:.|.:|..:|.| :|..|
 Frog     1 MQLTVKALKGKEANIQVSEGDTVLAVKRLVEEKLKVPVSQQRLLFRGKALADEHCLAHY-SIGPG 64

  Fly    66 TKLNLVVIKPCLRDSILRG----------FRKHYSEPLAERMTNEFMADFERKINEQSLDDLERL 120
            ::|||:|.:....:....|          .|||:|...|||:......|:||.::..||||:|||
 Frog    65 SRLNLMVKEQVAPEGHSGGNTAWKSLSVILRKHFSPTDAERVLEYVQKDYERSLSLLSLDDIERL 129

  Fly   121 ADSIVN 126
            |..|::
 Frog   130 ATRILH 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 29/70 (41%)
ubiquitin 6..72 CDD:278661 26/65 (40%)
ubl4aNP_001096510.1 Ubl_UBL4A_like 1..72 CDD:340505 29/71 (41%)
Tugs 87..133 CDD:375372 18/45 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10764
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5009
OMA 1 1.010 - - QHG48611
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005554
OrthoInspector 1 1.000 - - oto105186
Panther 1 1.100 - - LDO PTHR46555
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5392
SonicParanoid 1 1.000 - - X2416
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.