DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33722 and PUX1

DIOPT Version :9

Sequence 1:NP_001027152.1 Gene:CG33722 / 3772658 FlyBaseID:FBgn0064126 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_566815.1 Gene:PUX1 / 822350 AraportID:AT3G27310 Length:251 Species:Arabidopsis thaliana


Alignment Length:131 Identity:44/131 - (33%)
Similarity:67/131 - (51%) Gaps:11/131 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 NANDLPDSFFDLTVNDLKMVLRDLKRTSSGDDDAPLLTAKLRELERQKAMLAKLNQYKDCVLRIQ 366
            :|:|..|.|::.|..|...:|...|      :|..|.|.|:||.| :.|..:||.:   .|:|::
plant    60 SADDESDDFYEFTPADFYRLLATKK------EDKSLKTRKIREAE-EAARRSKLTK---AVIRVR 114

  Fly   367 FPDRFVLQGMFKPHEPLSKVEDFVREFLVQPGEQFHLFTIPPKKVLPS-GETLLELNFVPNAIVH 430
            |||...|:..|.|.|.:..:.|.|:..:..|...|:|:|.||||.:.. .:......|||.|||:
plant   115 FPDNHTLEATFHPSEKIQGLIDLVKRVVAHPDVPFYLYTTPPKKQIKDFSQDFYSAGFVPGAIVY 179

  Fly   431 F 431
            |
plant   180 F 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33722NP_001027152.1 TUG-UBL1 8..71 CDD:288347
UBQ 360..429 CDD:294102 23/69 (33%)
PUX1NP_566815.1 UBX2_UBXN9 109..181 CDD:340535 26/72 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4560
eggNOG 1 0.900 - - E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004856
OrthoInspector 1 1.000 - - oto4117
orthoMCL 1 0.900 - - OOG6_103915
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.