DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33722 and Ubxn6

DIOPT Version :9

Sequence 1:NP_001027152.1 Gene:CG33722 / 3772658 FlyBaseID:FBgn0064126 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001366290.1 Gene:Ubxn6 / 66530 MGIID:1913780 Length:442 Species:Mus musculus


Alignment Length:220 Identity:66/220 - (30%)
Similarity:91/220 - (41%) Gaps:36/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 KRTAPEEKASGSEPAKPLGESNQEQQPQPEPPKYDWGNGSGYLMNHPPEQKQAENEVEENPGRAP 280
            |.|.|.....|.|....||| :...|||             .|..|..:...||      |.||.
Mouse   225 KVTLPVPDQEGQEEFYVLGE-DARAQPQ-------------NLARHKQQLLDAE------PVRAT 269

  Fly   281 PVVKIIGPRQAVLFSLDESKKNANDLPDSFFDLTVNDLKMVLRDLKRTSSGDDDAPLLTAKLREL 345
            ...::...|.:.|.|..|       ||..||.||..::|...|  .||.:.:..:.|.|..:||.
Mouse   270 LDRQLRVFRPSALASHFE-------LPSDFFSLTAEEVKREQR--LRTEAVERLSSLRTKAMREK 325

  Fly   346 ERQKAMLAKLNQYKDCVLRIQFPDRFVLQGMFKPHEPLSKVEDFVREFLVQPGEQFHLFTIPPKK 410
            |.|:    :|.:|...::|::.||..:|||.|...|.||.:..||||.|......|.|.....:|
Mouse   326 EEQR----ELRKYTYALVRVRLPDGCLLQGTFYAREKLSALFRFVREALQNDWLPFELRASGGQK 386

  Fly   411 VLPSGETLL--ELNFVPNAIVHFGF 433
             |...|.|.  |...||:|::.|.:
Mouse   387 -LEENEALALNECGLVPSALLTFSW 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33722NP_001027152.1 TUG-UBL1 8..71 CDD:288347
UBQ 360..429 CDD:294102 25/70 (36%)
Ubxn6NP_001366290.1 Mediates interaction with LMAN1. /evidence=ECO:0000250|UniProtKB:Q9BZV1 1..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..111
VCP/p97-interacting motif (VIM). /evidence=ECO:0000250|UniProtKB:Q9BZV1 51..63
PUB_UBXD1 158..261 CDD:198418 13/49 (27%)
UBX_UBXN6 336..409 CDD:340536 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.