DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33722 and Ubxn6

DIOPT Version :9

Sequence 1:NP_001027152.1 Gene:CG33722 / 3772658 FlyBaseID:FBgn0064126 Length:478 Species:Drosophila melanogaster
Sequence 2:XP_038939868.1 Gene:Ubxn6 / 363332 RGDID:1590866 Length:454 Species:Rattus norvegicus


Alignment Length:187 Identity:56/187 - (29%)
Similarity:85/187 - (45%) Gaps:24/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 PEQKQAENEVEENPGRAPP------VVKIIGPRQAVLFSLDESKK--------NANDLPDSFFDL 313
            |:|:..|..|.....||.|      ..:::| .:.|..:||...:        :..:||..||.|
  Rat   244 PDQEGQEFYVLGEDARAQPQNLERHKQQLLG-AEPVRATLDRQLRVFRPSALASHFELPSDFFSL 307

  Fly   314 TVNDLKMVLRDLKRTSSGDDDAPLLTAKLRELERQKAMLAKLNQYKDCVLRIQFPDRFVLQGMFK 378
            |..::|...|  .||.:.:..:.|.|..:||.|.|:    :|.:|...:||::.||..:|||.|.
  Rat   308 TAEEVKREQR--LRTEAVERLSSLRTKAMREKEEQR----ELRKYTYALLRVRLPDGCLLQGTFY 366

  Fly   379 PHEPLSKVEDFVREFLVQPGEQFHLFTIPPKKVLPSGETLL--ELNFVPNAIVHFGF 433
            ..|.||.:..||||.|......|.|.....:| |...|.|.  |...||:|::.|.:
  Rat   367 AREKLSVLFQFVREALQNDWLPFELRASGGQK-LEENEALALNECGLVPSALLTFSW 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33722NP_001027152.1 TUG-UBL1 8..71 CDD:288347
UBQ 360..429 CDD:294102 26/70 (37%)
Ubxn6XP_038939868.1 PUB_UBXD1 171..275 CDD:198418 8/31 (26%)
UBX_UBXN6 348..421 CDD:340536 26/73 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.