powered by:
Protein Alignment CG33155 and ZK512.11
DIOPT Version :9
Sequence 1: | NP_001027417.1 |
Gene: | CG33155 / 3772655 |
FlyBaseID: | FBgn0053155 |
Length: | 60 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023004.1 |
Gene: | ZK512.11 / 3565910 |
WormBaseID: | WBGene00013989 |
Length: | 110 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 18/57 - (31%) |
Similarity: | 35/57 - (61%) |
Gaps: | 3/57 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 RKHKGT---LAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILSRFITIK 56
||:..| |.|:.::.|.:|.|:::|.||:||:|||..|...::...::::...:|
Worm 17 RKNGKTRLMLDVVHQMNQAVPTFNELFDEETFYVFAFLVVLVAVIFVIVMAKCFNVK 73
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0019595 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_129260 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.