DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33155 and ZK512.11

DIOPT Version :9

Sequence 1:NP_001027417.1 Gene:CG33155 / 3772655 FlyBaseID:FBgn0053155 Length:60 Species:Drosophila melanogaster
Sequence 2:NP_001023004.1 Gene:ZK512.11 / 3565910 WormBaseID:WBGene00013989 Length:110 Species:Caenorhabditis elegans


Alignment Length:57 Identity:18/57 - (31%)
Similarity:35/57 - (61%) Gaps:3/57 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKHKGT---LAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILSRFITIK 56
            ||:..|   |.|:.::.|.:|.|:::|.||:||:|||..|...::...::::...:|
 Worm    17 RKNGKTRLMLDVVHQMNQAVPTFNELFDEETFYVFAFLVVLVAVIFVIVMAKCFNVK 73



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019595
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_129260
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.