DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG34260

DIOPT Version :10

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:57 Identity:16/57 - (28%)
Similarity:25/57 - (43%) Gaps:13/57 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KIKINVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCP 125
            |.::|:|             ::.||.||:..:...|.|...|:...|..||:..|||
  Fly    81 KSRMNIA-------------DIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 15/54 (28%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:461928 16/57 (28%)

Return to query results.
Submit another query.