DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG14456

DIOPT Version :10

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:163 Identity:31/163 - (19%)
Similarity:67/163 - (41%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKL-LETPITKIKINVAILQR 79
            |..:.:.:.:|.:||..: |.:|......|    ..:..:|:..::: .|.....|.:.|.|..:
  Fly    19 SLAEKMMRPKFKDIKFWS-DEKFVSHKVVY----DNSDPHLNFSMEVHQELHDVDIHVEVRITNK 78

  Fly    80 LNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCP------YDHDIIVEKLPIS 138
            .:.|.....|.|::.|:.......:|:.|:::.|.:::.||..:||      :.|.|        
  Fly    79 QDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCPIAKGRYHWHRI-------- 135

  Fly   139 HVNTQVTKVLPVPHGDYLFHSNWYAYDINRAIV 171
            |:..::       .|.|..:..|:..|...|::
  Fly   136 HLKRKL-------QGSYFINKFWWPEDPTTAML 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 18/90 (20%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 19/95 (20%)

Return to query results.
Submit another query.