DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG12849

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:154 Identity:64/154 - (41%)
Similarity:97/154 - (62%) Gaps:3/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLYN 89
            ||.|:.|:..|..|.||:|||||:|:||||||||:.|:...|:...:....:..|.|....:.::
  Fly    22 EFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMRENRRVLYNFD 86

  Fly    90 VTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLPISHVNTQVTKVLPVPHGD 154
            ..:|:|||.:::| :.||.::|..|..|||:||:|||||||:::|||:.|:|..|..:  :|.|.
  Fly    87 FKVDSCKFMRDRK-HVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQHLNKLVQSI--IPDGR 148

  Fly   155 YLFHSNWYAYDINRAIVDVYATIS 178
            |:.:|.|....|.|..|.:|.|.|
  Fly   149 YMMNSTWMVAGIPRTDVILYFTKS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 32/84 (38%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 37/94 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472082
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.