DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG13590

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:153 Identity:48/153 - (31%)
Similarity:84/153 - (54%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLY 88
            ::..|..|.:.:..:....||.|||.||....|::.|..:| |...|.::...:::.|||||||:
  Fly    25 LKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVE-PARNISVHFKTMKKANGYKPFLF 88

  Fly    89 NVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLPISHVNTQVTKVLPVPHG 153
            :.|.|||:|.: :::.|:|:.::...::.|.|||:|||:.   ::.|...|   :|...:|:|.|
  Fly    89 DYTFDACEFMR-RRNQPVAKIIWYMIRNVSTINHTCPYEG---LQMLSDFH---KVDIPVPLPSG 146

  Fly   154 DYLFHSNWYAYDINRAIVDVYAT 176
            |||...:|......:...:||.|
  Fly   147 DYLLMVDWLFDGKTQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 29/84 (35%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472427
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.