DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG13561

DIOPT Version :10

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:179 Identity:55/179 - (30%)
Similarity:94/179 - (52%) Gaps:16/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVQLSIFLYSFH----QAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPI 67
            |.:|.:....:|    |.|.|  |.||:|::.|..|.....|.|.||.|....:|||..:|..|.
  Fly     4 LTELFLLFGLWHILQVQGVAK--FTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPK 66

  Fly    68 TKIKINVAILQRLNGYKPFLYNV-TIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDII 131
            ..:.:.:.:|::.:||||||||: ..|.|: |..::::|....:.|.|.:.:|:| .||...:|:
  Fly    67 GPVSMRMQLLKKASGYKPFLYNICQSDVCE-YLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIV 129

  Fly   132 VE--KLPISHVNTQVTKVLPVPHGDYLFHSNWYAYDINRAIVDVYATIS 178
            :|  :.|:     :|..::|:|.|||...:.:..:....|.|.||.|::
  Fly   130 LEHFRFPV-----KVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 28/87 (32%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 31/97 (32%)

Return to query results.
Submit another query.