DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG13561

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:179 Identity:55/179 - (30%)
Similarity:94/179 - (52%) Gaps:16/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVQLSIFLYSFH----QAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPI 67
            |.:|.:....:|    |.|.|  |.||:|::.|..|.....|.|.||.|....:|||..:|..|.
  Fly     4 LTELFLLFGLWHILQVQGVAK--FTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPK 66

  Fly    68 TKIKINVAILQRLNGYKPFLYNV-TIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDII 131
            ..:.:.:.:|::.:||||||||: ..|.|: |..::::|....:.|.|.:.:|:| .||...:|:
  Fly    67 GPVSMRMQLLKKASGYKPFLYNICQSDVCE-YLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIV 129

  Fly   132 VE--KLPISHVNTQVTKVLPVPHGDYLFHSNWYAYDINRAIVDVYATIS 178
            :|  :.|:     :|..::|:|.|||...:.:..:....|.|.||.|::
  Fly   130 LEHFRFPV-----KVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 28/87 (32%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472425
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.