DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33795

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:149 Identity:44/149 - (29%)
Similarity:80/149 - (53%) Gaps:6/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLYN 89
            :..|:.|.:.:..:...:.|.||||:|.....:... .:..|...:.|:...|:|.|||||:||.
  Fly    27 KLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNA-TIHHPTNDVVIDYRFLKRENGYKPWLYK 90

  Fly    90 VTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLPISHVNTQVTKVLPVPHGD 154
            ..||.|:|.: :..:.:.:.:|..||.:|||||:||:..||::..:   ::.|:: |.:|.|.|.
  Fly    91 KNIDGCRFLR-KPYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGM---YLRTEI-KAMPYPSGK 150

  Fly   155 YLFHSNWYAYDINRAIVDV 173
            |:...||..|...:.:.::
  Fly   151 YMLQINWSFYKKIQVVTNI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 32/84 (38%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.