DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33912

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:172 Identity:76/172 - (44%)
Similarity:112/172 - (65%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSIFLYS---FHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIK 71
            :|..:||   |.:....|||||::|.:||.:||..:|||||:|:|:|||:|::|.||:.||:|:|
  Fly     9 ISFLMYSTCYFTEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPISKVK 73

  Fly    72 INVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLP 136
            |...:.:|..||||||||.|:|||||.|:..|||:|.:...               |||:::|:.
  Fly    74 IRFGLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFFII---------------HDIVLDKMS 123

  Fly   137 ISHVNTQVTKVLPVPHGDYLFHSNWYAYDINRAIVDVYATIS 178
            ...||.::||:||.|.|.|:...:|.||:|||||..:|.|::
  Fly   124 YHSVNNKLTKILPFPEGHYMIEIHWIAYEINRAITKLYWTLT 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 34/84 (40%)
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 34/84 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472054
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.