DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33643

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:53 Identity:17/53 - (32%)
Similarity:24/53 - (45%) Gaps:2/53 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCP 125
            ||....|.||.:..||...:|||....:.:.|.:.......||.:||:  .||
  Fly    73 NVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKRFSNV--ECP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 17/53 (32%)
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.