DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33922

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:177 Identity:126/177 - (71%)
Similarity:154/177 - (87%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSPVRLVQLSIFLYSFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLET 65
            |.||.|||||||||::.|..:||:||.||||||||||||.|.||:||:|:|||||.||:||||:|
  Fly     1 MISPARLVQLSIFLFTIHLVICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKT 65

  Fly    66 PITKIKINVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDI 130
            |::.:|||:|..||||||||||||||:|.|:|||:|:|||:..|.::||||||||||||||||||
  Fly    66 PVSNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDI 130

  Fly   131 IVEKLPISHVNTQVTKVLPVPHGDYLFHSNWYAYDINRAIVDVYATI 177
            |::|:.|||.|||||.|||||||:||:.::||||:|.||.|||||.|
  Fly   131 ILDKVSISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVDVYAKI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 63/84 (75%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 62/83 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471984
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.