DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33796

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:140 Identity:42/140 - (30%)
Similarity:76/140 - (54%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLYN 89
            :..|:.|.:.:..:...:.|.|||::|.....:.....| .|...|.::....:|.|||:|:|.|
  Fly    28 KLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFL-YPTKSITVHYQTFKRENGYRPWLVN 91

  Fly    90 VTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLPISHVNTQVTKVLPVPHGD 154
            ..||.|:|.: :..:.:...|::.:::::||||:||...|:||..:   ::.|.|.: ||:|.||
  Fly    92 TQIDGCRFLR-KPYDALGILLFNIYRNFTNINHTCPLQGDMIVRNM---YLTTDVMR-LPLPTGD 151

  Fly   155 YLFHSNWYAY 164
            ||...:|..|
  Fly   152 YLLAIDWIFY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 29/84 (35%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 29/84 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.