DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33923 and CG33920

DIOPT Version :9

Sequence 1:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:177 Identity:104/177 - (58%)
Similarity:136/177 - (76%) Gaps:8/177 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRLVQLSIFLYSFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITK 69
            |.|:.|||   |..:...|.||.||.|.:||.:|:||:|||:|:|:|:|||:|::.||.:|||| 
  Fly     9 VALLALSI---SIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPIT- 69

  Fly    70 IKINVAILQRL---NGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDII 131
             |||..||:|.   |||:||::|:|:|||:|..|.||||||.|||.|.:.::|:||:||||||::
  Fly    70 -KINGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLV 133

  Fly   132 VEKLPISHVNTQVTKVLPVPHGDYLFHSNWYAYDINRAIVDVYATIS 178
            :|||||..||.|||||||||.||||:.:||.||||.||:|.||.|||
  Fly   134 IEKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTIS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 55/87 (63%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 54/86 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.